PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 63410
Common NameMICPUN_63410
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Chlorophyta; prasinophytes; Mamiellophyceae; Mamiellales; Mamiellaceae; Micromonas
Family NF-YC
Protein Properties Length: 246aa    MW: 26344.5 Da    PI: 4.8588
Description NF-YC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
63410genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YC55.11.7e-17981751996
  NF-YC  19 helPlarikkilkadedvkmisaeaPvllskacelfileltlrswlhaeenkrrtlkksdiaaavtrtdifdflvdiv 96 
              lPlar+k+i+k d++vk +  +a   ++k  elfi  l   s+   + nkr+t+k  d++  v r +  +fl d+v
  63410  98 LGLPLARVKRIMKLDKEVKNMQVDASKCVAKCAELFIESLVEGSFRSMKANKRKTIKYGDVEHHVLRKQRLEFLHDHV 175
            569*************************************************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003981.3E-4377IPR009071High mobility group box domain
PROSITE profilePS5011811.078376IPR009071High mobility group box domain
CDDcd000845.91E-8473No hitNo description
PfamPF005051.3E-7574IPR009071High mobility group box domain
Gene3DG3DSA:1.10.30.109.7E-12573IPR009071High mobility group box domain
SuperFamilySSF470955.5E-11574IPR009071High mobility group box domain
SuperFamilySSF471131.84E-1797183IPR009072Histone-fold
PfamPF008085.0E-17100160IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
Gene3DG3DSA:1.10.20.101.2E-21100175IPR009072Histone-fold
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 246 aa     Download sequence    Send to blast
MGGPKKMAPY LVFANDKRET AKELLIGEGN EKPTMGEIAK RVGVLWNQLD DAAKQVYKDK  60
ADELNAKAAK EYEEAGGDAA ADGADGDGDD GEKGAEELGL PLARVKRIMK LDKEVKNMQV  120
DASKCVAKCA ELFIESLVEG SFRSMKANKR KTIKYGDVEH HVLRKQRLEF LHDHVWAFRP  180
EEAQVGGAKG GKGGGKENDG DDDDVDGDDD TTPAKASPEA PPGARQVTDF FKKAAAEPEG  240
VATGA*
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCP0013310.0CP001331.1 Micromonas sp. RCC299 chromosome 13, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002505654.11e-177predicted protein
TrEMBLC1EFU71e-177C1EFU7_MICSR; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
ChlorophytaeOGCP46741111
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G54830.38e-12nuclear factor Y, subunit C3
Publications ? help Back to Top
  1. Worden AZ, et al.
    Green evolution and dynamic adaptations revealed by genomes of the marine picoeukaryotes Micromonas.
    Science, 2009. 324(5924): p. 268-72
    [PMID:19359590]